PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR11G02130.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 699aa    MW: 75827.4 Da    PI: 5.6619
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR11G02130.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.88.8e-12549595450
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                       k++r+   NReA r++Rq+Kka +++Lee+vk+L a N++L k+l+
  LPERR11G02130.2 549 PKKTRKPLGNREAVRKYRQKKKAHTAHLEEEVKKLHAINQQLVKKLQ 595
                      5999***************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.70.3302.2E-2375183IPR012677Nucleotide-binding alpha-beta plait domain
SuperFamilySSF549281.09E-36104269IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010217.285107183IPR000504RNA recognition motif domain
SMARTSM003601.6E-22108179IPR000504RNA recognition motif domain
PfamPF000761.1E-16109177IPR000504RNA recognition motif domain
CDDcd005902.41E-20109179No hitNo description
Gene3DG3DSA:3.30.70.3308.6E-17184264IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010212.219185266IPR000504RNA recognition motif domain
SMARTSM003602.6E-14186262IPR000504RNA recognition motif domain
PfamPF000761.1E-11187251IPR000504RNA recognition motif domain
Gene3DG3DSA:3.30.70.3301.8E-22265363IPR012677Nucleotide-binding alpha-beta plait domain
SuperFamilySSF549287.93E-22270357IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010215.613278355IPR000504RNA recognition motif domain
SMARTSM003604.8E-18279351IPR000504RNA recognition motif domain
PfamPF000767.2E-16280348IPR000504RNA recognition motif domain
Gene3DG3DSA:1.20.5.1709.2E-15545614No hitNo description
PfamPF077166.0E-13546603IPR004827Basic-leucine zipper domain
SMARTSM003382.1E-12546613IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.094548595IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.43E-8550596No hitNo description
CDDcd146862.70E-11551604No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
GO:0000166Molecular Functionnucleotide binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MPRRTDDAAS ANSIEPAKSE EHLEFDDDEE EVEEEEIEYE EIEEEVEEEE EVEEDDDVME  60
EVEEVDDEEE EESDENEDES NTKGAHQKDD TEKEKHAELL ALPPHGSEVY VGGISSDVSS  120
EDLKRLCEPV GEVVEVRMMR GKDDSRGYAF VAFRTRGLAL KAVKELNNAK LKGKRIRVSS  180
SQAKNKLFIG NVPNSWTEDD FRKAVEEVGP GVVKADLMKV SSSNRNRGYG FVEFYNHACA  240
EYARQKMSSP TFKLDSNAPT VSWADPKNND STSTSQVKSV YVKNLPKNVT QAQLKKLFEH  300
HGEITKVVLP PSRGGHDNRY GFVHFKDRSM AMRALQNTER YELDGQVLDC SLAKPPAADK  360
KDEKVSLPTT TGAPLLPSYP PLGYGIMSTP SAYGAVTTST AQPMLYAPGA PPGAAMVPML  420
LPDGRLVYVV QQPGGQLPLA SPPPQQVGRH SGSFSGRHHG DSGSGGRHGG GSGGSGSSRP  480
ASSIRHRMIA STNLNRGRCL CCACAASRRT VCSGEPPIGR RRRTPATPLS GGPGSSSDDD  540
SCGGNKDEPK KTRKPLGNRE AVRKYRQKKK AHTAHLEEEV KKLHAINQQL VKKLQGQAAL  600
EAEVMRLRTL LVDVRAKIDG ALGSYPFQSQ CGDANVSSCD GMSQCFAGKP GLGVNQNCAP  660
SVVNCHISPD SGQNLVVPHA LSPSDAVGSF MVSSNARAE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1464470GGRHGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0687000.0AK068700.1 Oryza sativa Japonica Group cDNA clone:J013160I09, full insert sequence.
GenBankAK0694930.0AK069493.1 Oryza sativa Japonica Group cDNA clone:J023024M07, full insert sequence.
GenBankAY2245810.0AY224581.1 Oryza sativa (japonica cultivar-group) isolate 30848 putative RNA-binding protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619732.10.0PREDICTED: heterogeneous nuclear ribonucleoprotein Q isoform X2
RefseqXP_015619733.10.0PREDICTED: heterogeneous nuclear ribonucleoprotein Q isoform X2
RefseqXP_015619734.10.0PREDICTED: heterogeneous nuclear ribonucleoprotein Q isoform X2
TrEMBLA0A0D9XNX00.0A0A0D9XNX0_9ORYZ; Uncharacterized protein
STRINGORGLA11G0021700.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.14e-30bZIP family protein